PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g080260.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 752aa    MW: 82221.9 Da    PI: 5.2773
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g080260.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-1860115156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++e+e++++++++p+ ++r+eL ++lgL+  qVk+WFqN+R+++k
  Solyc02g080260.2.1  60 KKRYHRHTQNQIQEMESFYKECNHPDDKQRKELGRRLGLEPLQVKFWFQNKRTQMK 115
                         688999***********************************************998 PP

2START2176.2e-682504681206
                         HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
               START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                         ela +a++el+++a+ eep+W  ss  e + ++e+ ++f+++ +      ++ea+r+s+vv+m++ +lve+l+d++ qW++ +a    ka+
  Solyc02g080260.2.1 250 ELAVTAMEELIRMAQTEEPLWLPSSgsETLCEQEYARIFPRGLGpkpatLNSEASRESAVVIMNHINLVEILMDVN-QWTTVFAglvsKAM 339
                         57899********************999999********99888********************************.************** PP

                         EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
               START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                         tlev+s+g      galq+m+ae+q++splvp R+ +f+Ry++q+g+g+wv+vdvS+d+ + ++    v R++++pSg+li++++ng+s+v
  Solyc02g080260.2.1 340 TLEVLSTGvagnhnGALQVMTAEFQVPSPLVPtRENYFLRYCKQHGEGTWVVVDVSLDNLRTVS----VPRCRRRPSGCLIQEMPNGYSRV 426
                         **************************************************************97....8********************** PP

                         EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         +wvehv+++++ +h ++++lv+sg+a+gak+wvatl+rqce+
  Solyc02g080260.2.1 427 IWVEHVEVDENAVHDIYKPLVNSGIAFGAKRWVATLDRQCER 468
                         ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-2142115IPR009057Homeodomain-like
SuperFamilySSF466895.43E-1845117IPR009057Homeodomain-like
PROSITE profilePS5007115.7157117IPR001356Homeobox domain
SMARTSM003897.9E-1658121IPR001356Homeobox domain
PfamPF000465.2E-1660115IPR001356Homeobox domain
CDDcd000864.20E-1660118No hitNo description
PROSITE profilePS5084847.22241471IPR002913START domain
SuperFamilySSF559611.58E-36242470No hitNo description
CDDcd088752.22E-125245467No hitNo description
SMARTSM002344.5E-63250468IPR002913START domain
PfamPF018521.6E-57251468IPR002913START domain
Gene3DG3DSA:3.30.530.202.2E-5317468IPR023393START-like domain
SuperFamilySSF559611.79E-24488719No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MFNNHQHLLD ISSSAQRTPD NELDFIRDEE FDSNSGADNM EAPNSGDDDQ ADPNQPPNKK  60
KRYHRHTQNQ IQEMESFYKE CNHPDDKQRK ELGRRLGLEP LQVKFWFQNK RTQMKAQHER  120
CENTQLRNEN EKLRAENIRY KEALSNAACP NCGGPAAIGE MSFDEHQLRI ENARLRDEID  180
RITGIAGKYV GKSALGYSHQ LPLPQPEAPR VLDLAFGPQS GLLGEMYAAG DLLRTAVTGL  240
TDAEKPVVIE LAVTAMEELI RMAQTEEPLW LPSSGSETLC EQEYARIFPR GLGPKPATLN  300
SEASRESAVV IMNHINLVEI LMDVNQWTTV FAGLVSKAMT LEVLSTGVAG NHNGALQVMT  360
AEFQVPSPLV PTRENYFLRY CKQHGEGTWV VVDVSLDNLR TVSVPRCRRR PSGCLIQEMP  420
NGYSRVIWVE HVEVDENAVH DIYKPLVNSG IAFGAKRWVA TLDRQCERLA SVLALNIPTG  480
DVGIITSPAG RKSMLKLAER MVMSFCAGVG ASTTHIWTTL SGSGADDVRV MTRKSIDDPG  540
RPPGIVLSAA TSFWLPVSPK RVFDFLRDEN SRNEWDILSN GGIVQEMAHI ANGRDPGNCV  600
SLLRVNTGTN SNQSNMLILQ ESTTDVTGSY VIYAPVDIAA MNVVLGGGDP DYVALLPSGF  660
AILPDGPMNY HGGGNSEIDS PGGSLLTVAF QILVDSVPTA KLSLGSVATV NSLIKCTVEK  720
IKGAVTSANA AGGLGWGRVE RSYKLDEGEG S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.258680.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF5187800.0UNVERIFIED: Solanum lycopersicum GL2 protein-like mRNA, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232734.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2
RefseqXP_010316614.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLK4B9P70.0K4B9P7_SOLLC; Uncharacterized protein
STRINGSolyc02g080260.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]